Hot Sell High Purity Peptide Teriparatide Acetate CAS: 52232-67-4 Finished Product Customization

Product Details
CAS No.: 52232-67-4
Formula: C172h278n52o47s2
Grade: Food Grade B
Gold Member Since 2024

Suppliers with verified business licenses

Audited Supplier

Audited by an independent third-party inspection agency

to see all verified strength labels (11)
  • Hot Sell High Purity Peptide Teriparatide Acetate CAS: 52232-67-4 Finished Product Customization
  • Hot Sell High Purity Peptide Teriparatide Acetate CAS: 52232-67-4 Finished Product Customization
  • Hot Sell High Purity Peptide Teriparatide Acetate CAS: 52232-67-4 Finished Product Customization
  • Hot Sell High Purity Peptide Teriparatide Acetate CAS: 52232-67-4 Finished Product Customization
  • Hot Sell High Purity Peptide Teriparatide Acetate CAS: 52232-67-4 Finished Product Customization
  • Hot Sell High Purity Peptide Teriparatide Acetate CAS: 52232-67-4 Finished Product Customization
Find Similar Products
  • Overview
  • Product Parameters
  • Detailed Photos
  • Company Profile
Overview

Basic Info.

Model NO.
52232-67-4
Function
Dermal System
Certification
GMP
Usage
Cosmetic Raw Materials
CAS
52232-67-4
MW
3890.49792
Mf
C172h278n52o47s2
Storage Temp.
−20°c
Purity
99%
Transport Package
25kg
Specification
25kg drum
Trademark
Bestway
Origin
China

Product Description

Hot Sell High Purity Peptide Teriparatide Acetate CAS: 52232-67-4 Finished Product Customization
Product Parameters

Hot Sell High Purity Peptide Teriparatide Acetate CAS: 52232-67-4 Finished Product Customization
 
English name Teriparatide Acetate
Cas number 52232-67-4
Synonyms PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Purity 99%
delivery 8-12days
Delivery time Next day of payment
Mode of transport Sea, air and truck transport
Express delivery EMS,UPS,FedEx,DHL,TNT

USES:A fragment of human parathyroid hormone (hPTH) peptide sequence containing the 34 N-terminal residues of hPTH. This fragment was also found to be an agonist at PTH1 and PTH2 receptors.

Hot Sell High Purity Peptide Teriparatide Acetate CAS: 52232-67-4 Finished Product Customization
The anabolic drug teriparatide acetate (TA), known as recombinant human parathyroid hormone 1-34, which directly promotes bone formation by generating new osteocytes, has been introduced as a novel therapeutic agent for osteoporosis. Distinct from antiresorptive drug treatment, patients with osteonecrosis of the jaw showed successful clinical outcomes after weekly administration of TA. In addition, adverse outcomes of long-term bisphosphonate treatment, such as bone fracture, were healed after usage of TA, and better bone mass and mineral density improvements at the lumbar spine and femoral neck were achieved with TA treatment than with bisphosphonate treatment.
 
 
Detailed Photos

 



Hot Sell High Purity Peptide Teriparatide Acetate CAS: 52232-67-4 Finished Product CustomizationHot Sell High Purity Peptide Teriparatide Acetate CAS: 52232-67-4 Finished Product Customization
Superiority

1.High quality and competitive price.
2.Free sample for your evaluation.
3.Promptly delivery by well-reputed shipping lines.
4.We will inform you all the information at every stage in advance.
5.Packaging can gear to buyers' special request. 

Our service

1. Reply your inquiry in 24 working hours.
2. Customized design is available. OEM are welcomed.
3. Exclusive and unique solution can be provided to our customer by our well-trained and professional engineers and
staff.
4. As an honest seller, we always use superior raw material, advanced machines, skilled technicians to ensure our products to be finished in high quality and stable feature.

Why Choose Us?
1. High-concentration products, strictly control the quality.
2. Reasonable and flexible price matched with high quality.
3. Spot samples can be shipped quickly after payment, saving time for receiving goods.
4.Full experience of large numbers containers loading in Chinese sea port.
5. Safe raw materials from China.
6. Have professional customs clearance capabilities and the best after-sales service.
Company Profile

 


Hot Sell High Purity Peptide Teriparatide Acetate CAS: 52232-67-4 Finished Product CustomizationHot Sell High Purity Peptide Teriparatide Acetate CAS: 52232-67-4 Finished Product Customization
Hot Sell High Purity Peptide Teriparatide Acetate CAS: 52232-67-4 Finished Product CustomizationHot Sell High Purity Peptide Teriparatide Acetate CAS: 52232-67-4 Finished Product CustomizationHot Sell High Purity Peptide Teriparatide Acetate CAS: 52232-67-4 Finished Product Customization
1. Pharmaceutical Expertise:
With years of experience in the pharmaceutical industry, our team brings extensive expertise in product development, manufacturing, and distribution.

2. High-Quality Products:
We adhere to stringent quality control standards and Good Manufacturing Practices (GMP) to ensure the safety and efficacy of our pharmaceutical products.

3. Diverse Product Range:
Our extensive product portfolio includes Active Pharmaceutical Ingredients (APIs), finished dosage forms, pharmaceutical intermediates, and customized pharmaceutical solutions to meet a wide range of needs.

4. Customization Capabilities:
We offer tailored solutions for pharmaceutical product development and manufacturing to meet the unique requirements of our clients.

5. Global Reach:
We have a strong international presence, allowing us to serve customers and partners worldwide. Our products are distributed in various regions, ensuring accessibility and reliability.

6. Regulatory Compliance:
We maintain strict adherence to international regulatory standards and guidelines, ensuring that our products meet all necessary regulatory requirements.

7. Responsive Customer Support:
Our dedicated customer support team is available to assist you promptly with inquiries, orders, and technical support.

8. Competitive Pricing:
We strive to provide competitive pricing for our high-quality pharmaceutical products, enabling cost-effective solutions for our clients.

9. Sustainable Practices:
We are committed to environmentally responsible practices in our manufacturing processes and operations, contributing to a sustainable future.

10. Innovation and Research: - We invest in research and development to stay at the forefront of pharmaceutical advancements and deliver innovative products to our customers.

11. Long-Term Partnerships: - We value long-term relationships with our customers and partners, fostering trust and collaboration for mutual success.

2. Transparent Communication: - We believe in transparent and open communication, ensuring that our clients are informed and confident in their dealings with us.
 

Send your message to this supplier

*From:
*To:
*Message:

Enter between 20 to 4,000 characters.

This is not what you are looking for? Post a Sourcing Request Now
Contact Supplier